(data stored in ACNUC1104 zone)

EMBL: CP001966.PE318

CP001966.PE318       Location/Qualifiers
FT   CDS             339014..339313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76972"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76972.1"
FT                   /translation="MPIDLIKVDYANYDTTSTLLGKSAAIADGLIAELVGNNTANLNAG
FT                   NWVGPDQGSYQDVHNACVEANERLAEVIRKAGIKVQTAATIHQAGQAQAASLYF"
     MPIDLIKVDY ANYDTTSTLL GKSAAIADGL IAELVGNNTA NLNAGNWVGP DQGSYQDVHN        60
     ACVEANERLA EVIRKAGIKV QTAATIHQAG QAQAASLYF                               99
//

If you have problems or comments...

PBIL Back to PBIL home page