(data stored in ACNUC1104 zone)

EMBL: CP001966.PE319

CP001966.PE319       Location/Qualifiers
FT   CDS             339315..340178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa8210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76973"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76973.1"
FT                   /translation="MPDNDSGGGLSAFGVSIDELSLLMRLADVTELAPIVLAVHPNVYR
FT                   PDDQSAVDLAVLPGLIAAGLVDADGAIDPEVARWLRALQAPAAEIALRVFDGDSALRGA
FT                   IVRHDDLVVVVFRHDDLLTLQGYRTDGEDFDSTVVDPVWRVLGSCDPADFDSLTLGAAE
FT                   LREIVSMYNPASTDPRGEREFRGRLREHDLPPHTVDVLVDAARYSGRRAEVVYHRVDLN
FT                   GVRTQAQWALGVMDTDQGRVLSTTTRGRGGDNDVILSPGTRRRFAEGLNELVARGGCVG
FT                   WFDIAN"
     MPDNDSGGGL SAFGVSIDEL SLLMRLADVT ELAPIVLAVH PNVYRPDDQS AVDLAVLPGL        60
     IAAGLVDADG AIDPEVARWL RALQAPAAEI ALRVFDGDSA LRGAIVRHDD LVVVVFRHDD       120
     LLTLQGYRTD GEDFDSTVVD PVWRVLGSCD PADFDSLTLG AAELREIVSM YNPASTDPRG       180
     EREFRGRLRE HDLPPHTVDV LVDAARYSGR RAEVVYHRVD LNGVRTQAQW ALGVMDTDQG       240
     RVLSTTTRGR GGDNDVILSP GTRRRFAEGL NELVARGGCV GWFDIAN                     287
//

If you have problems or comments...

PBIL Back to PBIL home page