(data stored in ACNUC1104 zone)

EMBL: CP001966.PE32

CP001966.PE32        Location/Qualifiers
FT   CDS             complement(34322..34786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0032"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: nfa:nfa850 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76686"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPR8"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG76686.1"
FT                   /translation="MQGLVLQLTRAGFLLLLWLCVWLVINALRSDARLASGLRPKQKEA
FT                   KPPRGSLFQRGSKTAKYLVVTHGPLANTRITLGQQPVLIGRADDSTLVLNDDYASTRHA
FT                   RLARDGDDWYVEDLGSTNGTYLARNKVTTPTRVPLGTPVRVGKTVIELRP"
     MQGLVLQLTR AGFLLLLWLC VWLVINALRS DARLASGLRP KQKEAKPPRG SLFQRGSKTA        60
     KYLVVTHGPL ANTRITLGQQ PVLIGRADDS TLVLNDDYAS TRHARLARDG DDWYVEDLGS       120
     TNGTYLARNK VTTPTRVPLG TPVRVGKTVI ELRP                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page