(data stored in ACNUC1104 zone)

EMBL: CP001966.PE320

CP001966.PE320       Location/Qualifiers
FT   CDS             340258..341997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76974"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC1"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_0067"
FT                   /protein_id="ADG76974.1"
FT                   /translation="MSDGATNVHLPFAEQNKTEGTPVPTTPQSVAGALASNAAAVRPVV
FT                   TPGPVSDEGTDSAPSTTEWEEPELPVVDDAGEAGPVPTAAEEAPAAAVADAAAVADAVA
FT                   SDDDRPTREQPVIVDEPAGRPEAEAAPTADTAAAGGQASPQGGPQVTGPQPAAQAPQQA
FT                   RTVPVPAQQPQQQWQGQAPQAQPGQHQFAQPHTGQFQQPQFAGQPPTGQFQAPVQGRPP
FT                   SPLPFGHAAPGQIAPPQPQHAGMPMRPMGESVSAPMSTASSSFQQHIRMSDSAMRVTGW
FT                   RAWLKRMGIDVGPSTSDQEHAERVHRIRVPKNKFHVTSVFADSAGGTLLVGVLGQILER
FT                   TRADNVVALDLDPDGGDLDQVTAWHQGGSTARTLIQQSDLSDRNQVDKHLAVTSTNLHV
FT                   LPTPWRFNGRDVADYDDVLDLYSIFRPHYSLALVDAGRGLQTVTGTGVLEISSALILPA
FT                   SATTRGVRKVAATIDWLRHHGWHGLLANTIVVINHTKKRGSVTVEQFDELFRAGQKLRV
FT                   HEIPYDPHLDADTPIDLDLLKPRTVRAFELLAADLADTFNSGYEPPAATKLAELQVRSH
FT                   EGR"
     MSDGATNVHL PFAEQNKTEG TPVPTTPQSV AGALASNAAA VRPVVTPGPV SDEGTDSAPS        60
     TTEWEEPELP VVDDAGEAGP VPTAAEEAPA AAVADAAAVA DAVASDDDRP TREQPVIVDE       120
     PAGRPEAEAA PTADTAAAGG QASPQGGPQV TGPQPAAQAP QQARTVPVPA QQPQQQWQGQ       180
     APQAQPGQHQ FAQPHTGQFQ QPQFAGQPPT GQFQAPVQGR PPSPLPFGHA APGQIAPPQP       240
     QHAGMPMRPM GESVSAPMST ASSSFQQHIR MSDSAMRVTG WRAWLKRMGI DVGPSTSDQE       300
     HAERVHRIRV PKNKFHVTSV FADSAGGTLL VGVLGQILER TRADNVVALD LDPDGGDLDQ       360
     VTAWHQGGST ARTLIQQSDL SDRNQVDKHL AVTSTNLHVL PTPWRFNGRD VADYDDVLDL       420
     YSIFRPHYSL ALVDAGRGLQ TVTGTGVLEI SSALILPASA TTRGVRKVAA TIDWLRHHGW       480
     HGLLANTIVV INHTKKRGSV TVEQFDELFR AGQKLRVHEI PYDPHLDADT PIDLDLLKPR       540
     TVRAFELLAA DLADTFNSGY EPPAATKLAE LQVRSHEGR                              579
//

If you have problems or comments...

PBIL Back to PBIL home page