(data stored in ACNUC1104 zone)

EMBL: CP001966.PE324

CP001966.PE324       Location/Qualifiers
FT   CDS             347256..349271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0335"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: mul:MUP011 transmembrane serine/threonine-
FT                   protein kinase PknQ; PFAM: Serine/threonine protein
FT                   kinase-related; tyrosine protein kinase; periplasmic
FT                   binding protein; SMART: serine/threonine protein kinase;
FT                   tyrosine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76978"
FT                   /db_xref="GOA:D5URC5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG76978.1"
FT                   /translation="MAEPGEVIAGYVVESVLGTGGMGTVYRVRHRTLPRSVALKVLQSQ
FT                   FSADPSVRARFDREADIVAGLKHPHIVDVYDRGESDGHLWIAMELVEGGNVAQIVQREG
FT                   PFSLDRAVAVIEQVADALDEAHGHGILHRDVKPANFLVDRGRRGEQIKLADFGIGAAQT
FT                   EVGQHTQTGTVVGTLAYTAPEALLGNPIDHRADIYSLACAAVVLLTGAPPFNTTISGQL
FT                   MLAHISQNPPSIRVKRPDLSPEIDYVLGRAMAKNPADRYNSAGEFADALSSAARRMSGA
FT                   AGIAPPPPPAGTNWQGTPSNPALATGFNPGAPAGYSGPPPGAAVPAQFYGGPSSPSNPS
FT                   MVPPSPAKSRRPLIVGAAAAVVVLVAIAIGAFALTGGGASDGRPALDSWSARTVTDING
FT                   DTRINERPTRIVALGPGDAEIVTALGFDVVAGGNGPKSELPSWVPSLKEVPTAGTSTNP
FT                   DRAAIEKAKPDLIIDTDPAGSAASKDLKSVANSIAVSPAGSKGWTWQEQMAYIAEALGA
FT                   KDRASAVRKTYEQRITELRAAHPDFTGKKVDLVHYDGQATRLATNAASPFQLLGQLGFT
FT                   MQVPAKGSGSSWLTVASVDLYAVVNTSSVDRTVVARTDPSAGNGGYDGLPAALTYGAPI
FT                   VILDTGSGVDALLYGGPLAIDTVADDVIPAIAKGVK"
     MAEPGEVIAG YVVESVLGTG GMGTVYRVRH RTLPRSVALK VLQSQFSADP SVRARFDREA        60
     DIVAGLKHPH IVDVYDRGES DGHLWIAMEL VEGGNVAQIV QREGPFSLDR AVAVIEQVAD       120
     ALDEAHGHGI LHRDVKPANF LVDRGRRGEQ IKLADFGIGA AQTEVGQHTQ TGTVVGTLAY       180
     TAPEALLGNP IDHRADIYSL ACAAVVLLTG APPFNTTISG QLMLAHISQN PPSIRVKRPD       240
     LSPEIDYVLG RAMAKNPADR YNSAGEFADA LSSAARRMSG AAGIAPPPPP AGTNWQGTPS       300
     NPALATGFNP GAPAGYSGPP PGAAVPAQFY GGPSSPSNPS MVPPSPAKSR RPLIVGAAAA       360
     VVVLVAIAIG AFALTGGGAS DGRPALDSWS ARTVTDINGD TRINERPTRI VALGPGDAEI       420
     VTALGFDVVA GGNGPKSELP SWVPSLKEVP TAGTSTNPDR AAIEKAKPDL IIDTDPAGSA       480
     ASKDLKSVAN SIAVSPAGSK GWTWQEQMAY IAEALGAKDR ASAVRKTYEQ RITELRAAHP       540
     DFTGKKVDLV HYDGQATRLA TNAASPFQLL GQLGFTMQVP AKGSGSSWLT VASVDLYAVV       600
     NTSSVDRTVV ARTDPSAGNG GYDGLPAALT YGAPIVILDT GSGVDALLYG GPLAIDTVAD       660
     DVIPAIAKGV K                                                            671
//

If you have problems or comments...

PBIL Back to PBIL home page