(data stored in ACNUC1104 zone)

EMBL: CP001966.PE325

CP001966.PE325       Location/Qualifiers
FT   CDS             349271..349861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_51460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76979"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC6"
FT                   /inference="similar to AA sequence:KEGG:ROP_51460"
FT                   /protein_id="ADG76979.1"
FT                   /translation="MAEQTLTAADLDRFAAALAAGKRPTVYLIEAVPSLGLAGGASAKV
FT                   VEVSGTTVTVRPAGVDDQLPYDARELRATKQPKPVKPATAAKAAPKAAPATAKSVAITV
FT                   FVGADNAAAVKVTRNANKPAGAREVALPAVQKALAGLGDKEAQGTVDEVLSTAREAAAD
FT                   RVAQLQAELAAAKKSLASLDRAKRGNASTTRGR"
     MAEQTLTAAD LDRFAAALAA GKRPTVYLIE AVPSLGLAGG ASAKVVEVSG TTVTVRPAGV        60
     DDQLPYDARE LRATKQPKPV KPATAAKAAP KAAPATAKSV AITVFVGADN AAAVKVTRNA       120
     NKPAGAREVA LPAVQKALAG LGDKEAQGTV DEVLSTAREA AADRVAQLQA ELAAAKKSLA       180
     SLDRAKRGNA STTRGR                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page