(data stored in ACNUC1104 zone)

EMBL: CP001966.PE327

CP001966.PE327       Location/Qualifiers
FT   CDS             350611..351162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0338"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: cai:Caci_2169
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76981"
FT                   /db_xref="GOA:D5URC8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC8"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADG76981.1"
FT                   /translation="MNALVVIDVQESFRQRANWSEVSNPGIVGDVNRLVVAARERGEPV
FT                   VWILHSEPGSGGVFDPASGHVVLQPGLVPLPGEPLLTKTTRNAFTSTELGRLLQRGGVT
FT                   GLTIAGIQTEQCCETTARLAADLGFDVDFVTEATATFPIVRPDTGAVLGTDAIIERTEF
FT                   ALAGRFARIRTLDEAVAGAA"
     MNALVVIDVQ ESFRQRANWS EVSNPGIVGD VNRLVVAARE RGEPVVWILH SEPGSGGVFD        60
     PASGHVVLQP GLVPLPGEPL LTKTTRNAFT STELGRLLQR GGVTGLTIAG IQTEQCCETT       120
     ARLAADLGFD VDFVTEATAT FPIVRPDTGA VLGTDAIIER TEFALAGRFA RIRTLDEAVA       180
     GAA                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page