(data stored in ACNUC1104 zone)

EMBL: CP001966.PE33

CP001966.PE33        Location/Qualifiers
FT   CDS             complement(34883..36169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0033"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: rer:RER_00340 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76687"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPR9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG76687.1"
FT                   /translation="MGILQRFERKLEGAVGDGFARVFGGKVVPQEVEAALQREAEDALQ
FT                   PLGDGAYLVPNKYVIAVSPTDQQTFEADRDLAIRAFSKHLDEYIHDNGWQTYGDVVVHF
FT                   EQSPQLHTGQFRARGTVDPDAVPQNLVPQRPPAESGADSMTNNPGYDQGRHGGQQYDDQ
FT                   GGYQQQGYDQQGYGQQPPQGGYDQNYAQQGYDQNYGQGGYQQPAYDQGGYQQQPAYDQG
FT                   GYQQQPGYDQGYQQPGYDQGYQQPAYDQGGYQQQPGYDQGYQQPAYDQNYGQNYAQPGY
FT                   DQGYQQQPGYDQGYQQPAYDQGGYQQQPGYDQNYAQPGYDQGGYGQQGGYQQPQSVTLY
FT                   LEDGSNRTFALREGANVIGRGQDAQFRLPDTGVSRRHVEIRWDGYAAVLNDLGSTNGTS
FT                   VNDVPVSNWELADGDRIRVGHSDIVVRFQ"
     MGILQRFERK LEGAVGDGFA RVFGGKVVPQ EVEAALQREA EDALQPLGDG AYLVPNKYVI        60
     AVSPTDQQTF EADRDLAIRA FSKHLDEYIH DNGWQTYGDV VVHFEQSPQL HTGQFRARGT       120
     VDPDAVPQNL VPQRPPAESG ADSMTNNPGY DQGRHGGQQY DDQGGYQQQG YDQQGYGQQP       180
     PQGGYDQNYA QQGYDQNYGQ GGYQQPAYDQ GGYQQQPAYD QGGYQQQPGY DQGYQQPGYD       240
     QGYQQPAYDQ GGYQQQPGYD QGYQQPAYDQ NYGQNYAQPG YDQGYQQQPG YDQGYQQPAY       300
     DQGGYQQQPG YDQNYAQPGY DQGGYGQQGG YQQPQSVTLY LEDGSNRTFA LREGANVIGR       360
     GQDAQFRLPD TGVSRRHVEI RWDGYAAVLN DLGSTNGTSV NDVPVSNWEL ADGDRIRVGH       420
     SDIVVRFQ                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page