(data stored in ACNUC1104 zone)

EMBL: CP001966.PE330

CP001966.PE330       Location/Qualifiers
FT   CDS             353423..354634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0341"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   svi:Svir_30250 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76984"
FT                   /db_xref="GOA:D5URD1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD1"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG76984.1"
FT                   /translation="MSDAFIYEAIRTPRGKLKGGSLTAIKPTDLVVGLIDEIKDRNPDL
FT                   DPAAVDDIVLGVVSPVGEQGADIARTASIVAGLPDTVAGVQINRFCASGLEATNMAAQK
FT                   VGSALGDDLVLAGGVESMSRVPMGSDFGALFYDPQYSYDNYIAPQGIGADLIATIEGFS
FT                   RDDVDQYSAQSQELAAKAWDEGRFAKSVVPVKDQNGLVVLDNDEHRRPGTTAADLGKLR
FT                   PAFTVVGEMGGFDAVALQKYTHVEKIDHVHTGGNSSGIVDGAALVLVGNEAGGKKAGLT
FT                   PRGRIVATASTGADPTIMLTGPTPATEKVLAKAGLTKDDIDVWELNEAFASVVLKWMKD
FT                   FKLDREQVNVNGGAIALGHPLGATGAMLVGTVLDELERTGGRYGLITLCIAGGMGSATI
FT                   IERI"
     MSDAFIYEAI RTPRGKLKGG SLTAIKPTDL VVGLIDEIKD RNPDLDPAAV DDIVLGVVSP        60
     VGEQGADIAR TASIVAGLPD TVAGVQINRF CASGLEATNM AAQKVGSALG DDLVLAGGVE       120
     SMSRVPMGSD FGALFYDPQY SYDNYIAPQG IGADLIATIE GFSRDDVDQY SAQSQELAAK       180
     AWDEGRFAKS VVPVKDQNGL VVLDNDEHRR PGTTAADLGK LRPAFTVVGE MGGFDAVALQ       240
     KYTHVEKIDH VHTGGNSSGI VDGAALVLVG NEAGGKKAGL TPRGRIVATA STGADPTIML       300
     TGPTPATEKV LAKAGLTKDD IDVWELNEAF ASVVLKWMKD FKLDREQVNV NGGAIALGHP       360
     LGATGAMLVG TVLDELERTG GRYGLITLCI AGGMGSATII ERI                         403
//

If you have problems or comments...

PBIL Back to PBIL home page