(data stored in ACNUC1104 zone)

EMBL: CP001966.PE334

CP001966.PE334       Location/Qualifiers
FT   CDS             complement(358595..359365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0345"
FT                   /product="ANTAR domain protein with unknown sensor"
FT                   /note="PFAM: ANTAR domain protein; GAF domain protein;
FT                   KEGG: kra:Krad_2459 response regulator receiver and ANTAR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76988"
FT                   /db_xref="GOA:D5URD5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD5"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADG76988.1"
FT                   /translation="MAVPAHKQSTEQLPSVLGTVHEAPPAEEVPLEELTLSERMGEIAR
FT                   LLREQSSDSESLLTAVTQFAVDQVPGASFASITLVDPKGGITHPVVIGDAAQRVADVQR
FT                   ELEEGPSVGATFESTTILVEDTATEPRWPRFAEAAKEAGVGSILSFCLYVQNDAYGTLD
FT                   LMAREANAFDAESQSIGSLFAVHAAVAFSAVREKEQIRAALTTRDVIGQAKGMIMERYK
FT                   LDSDGAFRLLARLSQDSNVRLAEVAEQVIEAGPD"
     MAVPAHKQST EQLPSVLGTV HEAPPAEEVP LEELTLSERM GEIARLLREQ SSDSESLLTA        60
     VTQFAVDQVP GASFASITLV DPKGGITHPV VIGDAAQRVA DVQRELEEGP SVGATFESTT       120
     ILVEDTATEP RWPRFAEAAK EAGVGSILSF CLYVQNDAYG TLDLMAREAN AFDAESQSIG       180
     SLFAVHAAVA FSAVREKEQI RAALTTRDVI GQAKGMIMER YKLDSDGAFR LLARLSQDSN       240
     VRLAEVAEQV IEAGPD                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page