(data stored in ACNUC1104 zone)

EMBL: CP001966.PE337

CP001966.PE337       Location/Qualifiers
FT   CDS             complement(363745..364470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0348"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: rop:ROP_51800
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76991"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD8"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ADG76991.1"
FT                   /translation="MHVLVTAADRAASEMPGVRSRHCFSFGDHYAPANTHHGVLLACND
FT                   ESVAAGRGFDTHPHRAVEIVTWVLGGALVHQDSEGHAGVVYPGLAQRMSAGTGILHSER
FT                   NDRPEPAGAGVRFVQMWLAPDDASAAPSYEQREVSADVDRGGLVTVASGDPARDAAIRI
FT                   GARGATLHCARLAPGATVDLPEAPFGHLYVAAGSAVADGTGALVDGDSLRTIADGIRIT
FT                   AGAGGAELLYWEMHRRLGD"
     MHVLVTAADR AASEMPGVRS RHCFSFGDHY APANTHHGVL LACNDESVAA GRGFDTHPHR        60
     AVEIVTWVLG GALVHQDSEG HAGVVYPGLA QRMSAGTGIL HSERNDRPEP AGAGVRFVQM       120
     WLAPDDASAA PSYEQREVSA DVDRGGLVTV ASGDPARDAA IRIGARGATL HCARLAPGAT       180
     VDLPEAPFGH LYVAAGSAVA DGTGALVDGD SLRTIADGIR ITAGAGGAEL LYWEMHRRLG       240
     D                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page