(data stored in ACNUC1104 zone)

EMBL: CP001966.PE342

CP001966.PE342       Location/Qualifiers
FT   CDS             369344..370549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0353"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: mkm:Mkms_3090 putative signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76996"
FT                   /db_xref="GOA:D5URE3"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG76996.1"
FT                   /translation="MDGTVSRLRRVVPTGRDDESHRPGDDDPRAPLWRGAQYFRAISVI
FT                   YAVGRHIDEAGRYERIGWSWVLIGLLVAFSALAALAYVRGFGRNRWFVGGEFVVAAALA
FT                   LSTWLVASPGFTQFNQALPTTLWLTNPVVSAAILGGPVAGLIGGVVIAAVNAIYRDVFP
FT                   ESTLRDANYPVFMSVGLGLGVAARMATKSREQVRAAERVAAEARARERLAREVHDGVLQ
FT                   ALAFLSRRCAELGGAATALGELAAQQERALRRLIAESPDTAGPDEAGGTVDLRELVRPL
FT                   ATAARSPVTLAEPGGPVALPAGTAAEVAAAVRNALDNTARHAGPGVRAFLLIEDVGDAV
FT                   LVTVRDDGTGIAPGRLDEARAEGRLGVSESIVGRIRALGGRAELTTDIGEGVEWELWVP
FT                   RN"
     MDGTVSRLRR VVPTGRDDES HRPGDDDPRA PLWRGAQYFR AISVIYAVGR HIDEAGRYER        60
     IGWSWVLIGL LVAFSALAAL AYVRGFGRNR WFVGGEFVVA AALALSTWLV ASPGFTQFNQ       120
     ALPTTLWLTN PVVSAAILGG PVAGLIGGVV IAAVNAIYRD VFPESTLRDA NYPVFMSVGL       180
     GLGVAARMAT KSREQVRAAE RVAAEARARE RLAREVHDGV LQALAFLSRR CAELGGAATA       240
     LGELAAQQER ALRRLIAESP DTAGPDEAGG TVDLRELVRP LATAARSPVT LAEPGGPVAL       300
     PAGTAAEVAA AVRNALDNTA RHAGPGVRAF LLIEDVGDAV LVTVRDDGTG IAPGRLDEAR       360
     AEGRLGVSES IVGRIRALGG RAELTTDIGE GVEWELWVPR N                           401
//

If you have problems or comments...

PBIL Back to PBIL home page