(data stored in ACNUC1104 zone)

EMBL: CP001966.PE344

CP001966.PE344       Location/Qualifiers
FT   CDS             complement(371187..373244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0355"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="KEGG: mgi:Mflv_2852 copper-translocating P-type
FT                   ATPase; TIGRFAM: copper-translocating P-type ATPase; heavy
FT                   metal translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76998"
FT                   /db_xref="GOA:D5URE5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE5"
FT                   /inference="protein motif:TFAM:TIGR01511"
FT                   /protein_id="ADG76998.1"
FT                   /translation="MNHSGMNHASMDHTALDHTATDHGGGHGGHGDHVAQFRRLFWIML
FT                   MLAVPVVALSDMFAMIAGYSLPAVPGLAWVSPILGTVMYVWGGRPFLTGAVSEIKARRP
FT                   GMMLLIGLAITVAFVASWGASLGLLHHQLDFWWELALLIVIMLLGHWIEMRSLARTTSA
FT                   LDSLAALLPEEAERIEDGAVVIVAPSELRVGDVVVVRPGGSVPADGAVVEGRAAMDESM
FT                   ITGESQTVERTVGETVTAGTVATDSGLRVRVTATGDDTALAGIGRLVEQAQNSTSRAQA
FT                   LADRAAGWLFWYALGAGALTAAVWTVLGEPDQAVIRTITVLVIACPHALGLAIPLVVSI
FT                   ATERAAKAGVLVKDRMALETMRTVDTVLFDKTGTLTRGEPVVTEIVGGGEVLALAAAAE
FT                   ADSEHPLARAIVRSARDRGLTVPAATGFTSSPAVGVTAVVDGATIRVGGPNLLAEENVR
FT                   ELPAADAWRERGAIILHVLRDGAVIGALALADEVRPESREAVDALHALGIQVVMITGDA
FT                   EAVAHAVADELCIDRVYAGVRPEDKAAKVAELQGETRIVAMVGDGVNDAPALAQANVGL
FT                   AIGAGTDVAIASAGVILAGDDPRSVLSVIELSHASYRKMKQNLWWAAGYNLISVPLAAG
FT                   VLAPIGFVLPMSVGAILMSLSTVVVALNAQLLRRLDLRPQTVTARILQRR"
     MNHSGMNHAS MDHTALDHTA TDHGGGHGGH GDHVAQFRRL FWIMLMLAVP VVALSDMFAM        60
     IAGYSLPAVP GLAWVSPILG TVMYVWGGRP FLTGAVSEIK ARRPGMMLLI GLAITVAFVA       120
     SWGASLGLLH HQLDFWWELA LLIVIMLLGH WIEMRSLART TSALDSLAAL LPEEAERIED       180
     GAVVIVAPSE LRVGDVVVVR PGGSVPADGA VVEGRAAMDE SMITGESQTV ERTVGETVTA       240
     GTVATDSGLR VRVTATGDDT ALAGIGRLVE QAQNSTSRAQ ALADRAAGWL FWYALGAGAL       300
     TAAVWTVLGE PDQAVIRTIT VLVIACPHAL GLAIPLVVSI ATERAAKAGV LVKDRMALET       360
     MRTVDTVLFD KTGTLTRGEP VVTEIVGGGE VLALAAAAEA DSEHPLARAI VRSARDRGLT       420
     VPAATGFTSS PAVGVTAVVD GATIRVGGPN LLAEENVREL PAADAWRERG AIILHVLRDG       480
     AVIGALALAD EVRPESREAV DALHALGIQV VMITGDAEAV AHAVADELCI DRVYAGVRPE       540
     DKAAKVAELQ GETRIVAMVG DGVNDAPALA QANVGLAIGA GTDVAIASAG VILAGDDPRS       600
     VLSVIELSHA SYRKMKQNLW WAAGYNLISV PLAAGVLAPI GFVLPMSVGA ILMSLSTVVV       660
     ALNAQLLRRL DLRPQTVTAR ILQRR                                             685
//

If you have problems or comments...

PBIL Back to PBIL home page