(data stored in ACNUC1104 zone)

EMBL: CP001966.PE345

CP001966.PE345       Location/Qualifiers
FT   CDS             complement(373284..374729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0356"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; Fumarase C-like; KEGG:
FT                   aau:AAur_3794 aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76999"
FT                   /db_xref="GOA:D5URE6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE6"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ADG76999.1"
FT                   /translation="MGMTETTRSEHDLLGDIDVPADAYYGAHTARALLNFPITGIPIAT
FT                   HTHLVNALACVKQAAAEANRQLGVLTDERTEAIVAACERIRGGGLHEWFVVDTIAGGAG
FT                   TSTNMNANEVIANAALEELGRPRGDYATLHPLDHVNLGQSTNDVYPTAIKIALITQLRD
FT                   LQEALTGLRAEFAAKSEEFGGIVKMGRTQLQDAVPMTLGQEFGAFATTLGEDIVRLQEA
FT                   TRLLHELNIGGTAIGTALNSHPGYRAKVIERLREITGIYELVGASDLIEATADVGVFVQ
FT                   LSGVLKRIAVKLSKTCNDLRLLSSGPRAGLNEIHLPAVQAGSSIMPGKVNPVIPEVVNQ
FT                   IAYEVIGHDVTITMAAEGGQLQLNAFEPIIARSLVESIAHLTRGARVLGERCVAGITAN
FT                   TARLEQSVAESIGVVTALSPSIGYAAATAVAAQALEEGRGVVEIVRERGLLDEATLDSL
FT                   LSPEYLTGHPPHALHPGSAEKHD"
     MGMTETTRSE HDLLGDIDVP ADAYYGAHTA RALLNFPITG IPIATHTHLV NALACVKQAA        60
     AEANRQLGVL TDERTEAIVA ACERIRGGGL HEWFVVDTIA GGAGTSTNMN ANEVIANAAL       120
     EELGRPRGDY ATLHPLDHVN LGQSTNDVYP TAIKIALITQ LRDLQEALTG LRAEFAAKSE       180
     EFGGIVKMGR TQLQDAVPMT LGQEFGAFAT TLGEDIVRLQ EATRLLHELN IGGTAIGTAL       240
     NSHPGYRAKV IERLREITGI YELVGASDLI EATADVGVFV QLSGVLKRIA VKLSKTCNDL       300
     RLLSSGPRAG LNEIHLPAVQ AGSSIMPGKV NPVIPEVVNQ IAYEVIGHDV TITMAAEGGQ       360
     LQLNAFEPII ARSLVESIAH LTRGARVLGE RCVAGITANT ARLEQSVAES IGVVTALSPS       420
     IGYAAATAVA AQALEEGRGV VEIVRERGLL DEATLDSLLS PEYLTGHPPH ALHPGSAEKH       480
     D                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page