(data stored in ACNUC1104 zone)

EMBL: CP001966.PE346

CP001966.PE346       Location/Qualifiers
FT   CDS             complement(374803..375081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_2469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77000"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE7"
FT                   /inference="similar to AA sequence:KEGG:MAB_2469"
FT                   /protein_id="ADG77000.1"
FT                   /translation="MTTTYTVDGRRVVDRDSFYAELGRAVNGPGGYFGGNLDALVDCLR
FT                   GGFGTPEDEPFDFRITHADDVRTALGPKLYAEVVDVFATSGVPLQTA"
     MTTTYTVDGR RVVDRDSFYA ELGRAVNGPG GYFGGNLDAL VDCLRGGFGT PEDEPFDFRI        60
     THADDVRTAL GPKLYAEVVD VFATSGVPLQ TA                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page