(data stored in ACNUC1104 zone)

EMBL: CP001966.PE347

CP001966.PE347       Location/Qualifiers
FT   CDS             complement(375083..375469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0358"
FT                   /product="guanine-specific ribonuclease N1 and T1"
FT                   /note="PFAM: guanine-specific ribonuclease N1 and T1; KEGG:
FT                   mab:MAB_2468 putative guanyl-specific ribonuclease Sa"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77001"
FT                   /db_xref="GOA:D5URE8"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE8"
FT                   /inference="protein motif:PFAM:PF00545"
FT                   /protein_id="ADG77001.1"
FT                   /translation="MRTATRTAGALLVAFGLSTAVTSLPSASAALPSCALSSLPPEATD
FT                   TVNLIHQGGPFPYPKNDGVVFQNREGILPAKASGYYHEYTVPTPGSSTRGARRIVTGGT
FT                   PLTSPPVYYYTGDHYSSFCTLTGA"
     MRTATRTAGA LLVAFGLSTA VTSLPSASAA LPSCALSSLP PEATDTVNLI HQGGPFPYPK        60
     NDGVVFQNRE GILPAKASGY YHEYTVPTPG SSTRGARRIV TGGTPLTSPP VYYYTGDHYS       120
     SFCTLTGA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page