(data stored in ACNUC1104 zone)

EMBL: CP001966.PE348

CP001966.PE348       Location/Qualifiers
FT   CDS             complement(375522..376223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0359"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rop:ROP_11210
FT                   putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77002"
FT                   /db_xref="GOA:D5URE9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77002.1"
FT                   /translation="MTSATAVSAHTDTLKPMPRPSTRAVERHTPGPTRAEAKERTRQAL
FT                   LDEALALAGERAFASLSLREVAKAAGVVPTAFYRHFASMDDLGVTLVEDAMRVLRRMLR
FT                   EGRRDGRPSGEEAVRVVAKQARANDAEFQFLVRERYGGSPELQRAIDVELRLFAKDLTH
FT                   DLSRIPALADWSVEDLDMIADLYVTIILGFVAELVRIDPRNTRDENELIDRTKRQLTVV
FT                   ALGLGSYRPRE"
     MTSATAVSAH TDTLKPMPRP STRAVERHTP GPTRAEAKER TRQALLDEAL ALAGERAFAS        60
     LSLREVAKAA GVVPTAFYRH FASMDDLGVT LVEDAMRVLR RMLREGRRDG RPSGEEAVRV       120
     VAKQARANDA EFQFLVRERY GGSPELQRAI DVELRLFAKD LTHDLSRIPA LADWSVEDLD       180
     MIADLYVTII LGFVAELVRI DPRNTRDENE LIDRTKRQLT VVALGLGSYR PRE              233
//

If you have problems or comments...

PBIL Back to PBIL home page