(data stored in ACNUC1104 zone)

EMBL: CP001966.PE35

CP001966.PE35        Location/Qualifiers
FT   CDS             complement(38180..38713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_4901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76689"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76689.1"
FT                   /translation="MTAPQIRSETVDWDIWYPDAYEISAEGVRGFARAVRDPHVPFGAR
FT                   GILATDTPVPITLLAGPMFDAAAILVSRAIPNCNLSRIVHAAQQFTTVRPLRIGQRISF
FT                   GARLTSHIVKANTDVIAIEVTAYADDAAHLAALITIAHSATAGPGVDLDAVADQIMLTG
FT                   TGPSDSDAYTATAG"
     MTAPQIRSET VDWDIWYPDA YEISAEGVRG FARAVRDPHV PFGARGILAT DTPVPITLLA        60
     GPMFDAAAIL VSRAIPNCNL SRIVHAAQQF TTVRPLRIGQ RISFGARLTS HIVKANTDVI       120
     AIEVTAYADD AAHLAALITI AHSATAGPGV DLDAVADQIM LTGTGPSDSD AYTATAG          177
//

If you have problems or comments...

PBIL Back to PBIL home page