(data stored in ACNUC1104 zone)

EMBL: CP001966.PE354

CP001966.PE354       Location/Qualifiers
FT   CDS             complement(382501..383166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa54850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77008"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF5"
FT                   /inference="similar to AA sequence:KEGG:nfa54850"
FT                   /protein_id="ADG77008.1"
FT                   /translation="MTGTATDPSEASLDAARRVLLVWDAPNLDMGLGSILGGRPTAAHR
FT                   PRFDALGRWLLEYTAALESDTDSRLEPEATVFTNIAPGTADVVRPWVEALRNVGYAVFA
FT                   KPKVDEDSDVDADMLDHIEVRRYRPGLGGLLVASADGQAFREPLEEIAATGVPVKVLGF
FT                   REHAAWALQSPTLEFVDLEDIAGVFREPLPRVSLDSLPDEGAWLQPFRPLSSLLSSRV"
     MTGTATDPSE ASLDAARRVL LVWDAPNLDM GLGSILGGRP TAAHRPRFDA LGRWLLEYTA        60
     ALESDTDSRL EPEATVFTNI APGTADVVRP WVEALRNVGY AVFAKPKVDE DSDVDADMLD       120
     HIEVRRYRPG LGGLLVASAD GQAFREPLEE IAATGVPVKV LGFREHAAWA LQSPTLEFVD       180
     LEDIAGVFRE PLPRVSLDSL PDEGAWLQPF RPLSSLLSSR V                           221
//

If you have problems or comments...

PBIL Back to PBIL home page