(data stored in ACNUC1104 zone)

EMBL: CP001966.PE355

CP001966.PE355       Location/Qualifiers
FT   CDS             complement(383163..383966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0366"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="TIGRFAM: tRNA (guanine-N(7)-)-methyltransferase;
FT                   KEGG: nfa:nfa54840 tRNA (guanine-N(7)-)- methyltransferase;
FT                   PFAM: putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77009"
FT                   /db_xref="GOA:D5URF6"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF6"
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /protein_id="ADG77009.1"
FT                   /translation="MESVPESQDPRAEHRRLYPRVTSFRSRRGALTPSQQRAMDEMWPT
FT                   IGRDIPPARPVDGAPNEDAFPAPSHPLDAPAWFGRTAPLIVEIGCGTGTSTVAMAEAEP
FT                   ERDVLAVEVYLPGIAQLVGGVQRQGLTNVRVVRGDGVAVLEDMIAPGSLEGVRVYFPDP
FT                   WPKARHHKRRLLQPRMFSLIADRLRVGGILHVATDHADYAEAIAEVAPSEPLLRPVELP
FT                   PRLADANLPISVDRPVTKFQDKAAQVGREIHEFVWERVVEEGAHR"
     MESVPESQDP RAEHRRLYPR VTSFRSRRGA LTPSQQRAMD EMWPTIGRDI PPARPVDGAP        60
     NEDAFPAPSH PLDAPAWFGR TAPLIVEIGC GTGTSTVAMA EAEPERDVLA VEVYLPGIAQ       120
     LVGGVQRQGL TNVRVVRGDG VAVLEDMIAP GSLEGVRVYF PDPWPKARHH KRRLLQPRMF       180
     SLIADRLRVG GILHVATDHA DYAEAIAEVA PSEPLLRPVE LPPRLADANL PISVDRPVTK       240
     FQDKAAQVGR EIHEFVWERV VEEGAHR                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page