(data stored in ACNUC1104 zone)

EMBL: CP001966.PE359

CP001966.PE359       Location/Qualifiers
FT   CDS             387070..388110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_52280 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77013"
FT                   /db_xref="GOA:D5URG0"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77013.1"
FT                   /translation="MTVLVAAQDAAGAIAVARALDGAPAVVGADGALTPLAEQPREVDA
FT                   AVYVLDACVPADPVDSVALGRLRARWGTVVAATGAEAYPDSAATCAESARRLGVAVLPV
FT                   EPGLAAIRAALACAPAPEPCVPAVPARPNPALERADRSAYLRSTVARMRAALLAESAER
FT                   FRGRDDDASPERVRARLERTVAGLELSLHEYLRAAYRGTFAGWPSPPEPAVPVLSRPDP
FT                   TEPPAHRRRPEDAAVLVLGASAGLGIGRAVAAPLEALGTLRWLALPISLVVGLAAALWL
FT                   LRVRRRTSARASRRAWSDGAAAAHRQRVEYEIAAALVAAESDAALRLARGPGTEPRPDA
FT                   SNGHGA"
     MTVLVAAQDA AGAIAVARAL DGAPAVVGAD GALTPLAEQP REVDAAVYVL DACVPADPVD        60
     SVALGRLRAR WGTVVAATGA EAYPDSAATC AESARRLGVA VLPVEPGLAA IRAALACAPA       120
     PEPCVPAVPA RPNPALERAD RSAYLRSTVA RMRAALLAES AERFRGRDDD ASPERVRARL       180
     ERTVAGLELS LHEYLRAAYR GTFAGWPSPP EPAVPVLSRP DPTEPPAHRR RPEDAAVLVL       240
     GASAGLGIGR AVAAPLEALG TLRWLALPIS LVVGLAAALW LLRVRRRTSA RASRRAWSDG       300
     AAAAHRQRVE YEIAAALVAA ESDAALRLAR GPGTEPRPDA SNGHGA                      346
//

If you have problems or comments...

PBIL Back to PBIL home page