(data stored in ACNUC1104 zone)

EMBL: CP001966.PE36

CP001966.PE36        Location/Qualifiers
FT   CDS             38890..39852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0036"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="KEGG: mpa:MAP0135 CmaA1; PFAM:
FT                   Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76690"
FT                   /db_xref="GOA:D5UPS2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS2"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ADG76690.1"
FT                   /translation="MPNLDPHFDDVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLE
FT                   EAQLAKVDLSLGKLDLKPGMTLLDVGCGWGTTLIRALEKYDVNVIGLTLSKNQYEAVSR
FT                   RLGEVQSERSAEVRLQGWEEFDGAVDAIVSIGAFEHFTHERHLAFFDRAFDILPAGGRA
FT                   MIHTIMTFGMDTFRGESRVTRADFDFFRFIRTEIFPGGELPITKYFPLLAEMGGFDVTR
FT                   IQSLQPHYAKTLDIWAANLEAAREQALHIHPQSVYDTYIKYLTGCADAFRRGLIDVRQH
FT                   TLVKPEHDARHRTLDEVLAMHPEVDAAAGTTAARFIPSR"
     MPNLDPHFDD VQAHYDLSDD FFRLFLDPTQ TYSCAYFERD DMTLEEAQLA KVDLSLGKLD        60
     LKPGMTLLDV GCGWGTTLIR ALEKYDVNVI GLTLSKNQYE AVSRRLGEVQ SERSAEVRLQ       120
     GWEEFDGAVD AIVSIGAFEH FTHERHLAFF DRAFDILPAG GRAMIHTIMT FGMDTFRGES       180
     RVTRADFDFF RFIRTEIFPG GELPITKYFP LLAEMGGFDV TRIQSLQPHY AKTLDIWAAN       240
     LEAAREQALH IHPQSVYDTY IKYLTGCADA FRRGLIDVRQ HTLVKPEHDA RHRTLDEVLA       300
     MHPEVDAAAG TTAARFIPSR                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page