(data stored in ACNUC1104 zone)

EMBL: CP001966.PE360

CP001966.PE360       Location/Qualifiers
FT   CDS             388100..388435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_4503c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77014"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77014.1"
FT                   /translation="MEPEFGLFAGGDSDAAGPDLFDGAVPAAAPSSEGLWVSADGGWFD
FT                   VHALDTDGDGHPDTGTLSGPGGTAVFTDLDADGVADVYHRIRPDGTFETWRFSGGSWHL
FT                   LDRGEVM"
     MEPEFGLFAG GDSDAAGPDL FDGAVPAAAP SSEGLWVSAD GGWFDVHALD TDGDGHPDTG        60
     TLSGPGGTAV FTDLDADGVA DVYHRIRPDG TFETWRFSGG SWHLLDRGEV M                111
//

If you have problems or comments...

PBIL Back to PBIL home page