(data stored in ACNUC1104 zone)

EMBL: CP001966.PE363

CP001966.PE363       Location/Qualifiers
FT   CDS             392525..393835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0375"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="KEGG: msm:MSMEG_1682 flavin-containing monooxygenase
FT                   FMO"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77017"
FT                   /db_xref="GOA:D5URG4"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG4"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_1682"
FT                   /protein_id="ADG77017.1"
FT                   /translation="MSDTEVEALVIGAGQAGIAMSEHLGAHEIPHLVVERDRIAERWHS
FT                   WRWDSMVANGPAWHDRFPGLEFDIRPDDFAGKRQVADYLCAYAEMINAPIRTGVEVTSV
FT                   TKCTGRAGFRVDTSQGVIHARYVISATGAFQKPVIPAILPQHARIHQIHSVDYRNPQQL
FT                   PGGAVLVIGAGSSGVQIADELRSSGRRVFLSVGPHDRPPRRYRGRDFCWWLGVLGQWDA
FT                   ATPPAGAEHVTIAVSGANGGRTVDFRALAADGITLLGRAERFERGALRFSDDLRANIEA
FT                   GDASYLSMLDEADDYVLRNGLDLPEDPQARTSLPDPECMLDPVREVDLAAEDIRSVVWA
FT                   TGFANDFGWLKVDVFDDRGRPEHQRGVCTEPGIYFLGLPWLSRRGSSFIWGVWHDARHL
FT                   ADQIAIQQGYLRYTGSECARSERGADRNDRSAQGARP"
     MSDTEVEALV IGAGQAGIAM SEHLGAHEIP HLVVERDRIA ERWHSWRWDS MVANGPAWHD        60
     RFPGLEFDIR PDDFAGKRQV ADYLCAYAEM INAPIRTGVE VTSVTKCTGR AGFRVDTSQG       120
     VIHARYVISA TGAFQKPVIP AILPQHARIH QIHSVDYRNP QQLPGGAVLV IGAGSSGVQI       180
     ADELRSSGRR VFLSVGPHDR PPRRYRGRDF CWWLGVLGQW DAATPPAGAE HVTIAVSGAN       240
     GGRTVDFRAL AADGITLLGR AERFERGALR FSDDLRANIE AGDASYLSML DEADDYVLRN       300
     GLDLPEDPQA RTSLPDPECM LDPVREVDLA AEDIRSVVWA TGFANDFGWL KVDVFDDRGR       360
     PEHQRGVCTE PGIYFLGLPW LSRRGSSFIW GVWHDARHLA DQIAIQQGYL RYTGSECARS       420
     ERGADRNDRS AQGARP                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page