(data stored in ACNUC1104 zone)

EMBL: CP001966.PE364

CP001966.PE364       Location/Qualifiers
FT   CDS             393832..394281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0376"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: msm:MSMEG_1681
FT                   endoribonuclease L-PSP superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77018"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG5"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADG77018.1"
FT                   /translation="MNTPAARPTHRRIRPFNTRDTYPEQNLDNDLCQAVVAGGVVYLRG
FT                   QIGQDLDTRESVGVGDVKVQAHQAMRNISQLLEEAGSSLRDIVKVTVYLTDVRYREVVY
FT                   RVMGEWLAGVYPVSTGLVVDALARPEWLVEIDAVAVLSAPEGVAR"
     MNTPAARPTH RRIRPFNTRD TYPEQNLDND LCQAVVAGGV VYLRGQIGQD LDTRESVGVG        60
     DVKVQAHQAM RNISQLLEEA GSSLRDIVKV TVYLTDVRYR EVVYRVMGEW LAGVYPVSTG       120
     LVVDALARPE WLVEIDAVAV LSAPEGVAR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page