(data stored in ACNUC1104 zone)

EMBL: CP001966.PE369

CP001966.PE369       Location/Qualifiers
FT   CDS             397470..399572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0381"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; FAD-
FT                   dependent pyridine nucleotide-disulphide oxidoreductase;
FT                   KEGG: rop:ROP_14630 histamine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77023"
FT                   /db_xref="GOA:D5URH0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037348"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH0"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADG77023.1"
FT                   /translation="MRDPRYDILFEPVRIGPVTARNRFFQVPHCNGMGYRDPSGEAAMR
FT                   RVKAEGGWAVVCTEQVEIHPTSDIGPFIELRLWDDHDLPAIARIAEQIHEGGALAGIEL
FT                   AHNGLNSPNLISRETPLAPQHLPVVSWNLDPVQARAMTKADIADMRRWHADSVRRSLQA
FT                   GYDIVYVYAGHAIGGLHHFLSRRYNNRSDEYGGSLENRVRLIREILEDTREIVEGKAAV
FT                   ACRISVDELLGDEGITRAEMEDVFGLIGELPDLWDLVLGSWEDDSVTSRFGPEGEQEPF
FT                   VTGLRDLTSKPVVGVGRFTSPDTMVRHVTSGILDLIGAARPSIADPFMPNKIERGDLDD
FT                   IRECIGCNICVSGDFTMSPIRCTQNPTMGEEFRRGWHPESIAPKRSSSSVLVIGAGPAG
FT                   LEAARALGNRGYPVTVTEASRILGGRVVGESKLPGLSAWIRVIDYRLHQIARLDNVELY
FT                   RESAMNADDVLDVGFDHVVVATGASWRRDGVGRWHTRPIDIEPGVDVLTPDDIIAGARP
FT                   QGHRVVLFDDDHYYLGAVIAELLASEGFVVTLVTPVPQVSQWTTNTMEAHRIRKRIIEA
FT                   GVEVRTDTAVSTVMVDGVVTACRFTGRTGWIDADSVVLVTARLPHDDLYTALHDRASEW
FT                   SDAGVQSVRGVGDAWAPGTIAAAVWSGHRFAEELDAPLGDAPVPFRREVTQLTIEPVFP
FT                   RPASSS"
     MRDPRYDILF EPVRIGPVTA RNRFFQVPHC NGMGYRDPSG EAAMRRVKAE GGWAVVCTEQ        60
     VEIHPTSDIG PFIELRLWDD HDLPAIARIA EQIHEGGALA GIELAHNGLN SPNLISRETP       120
     LAPQHLPVVS WNLDPVQARA MTKADIADMR RWHADSVRRS LQAGYDIVYV YAGHAIGGLH       180
     HFLSRRYNNR SDEYGGSLEN RVRLIREILE DTREIVEGKA AVACRISVDE LLGDEGITRA       240
     EMEDVFGLIG ELPDLWDLVL GSWEDDSVTS RFGPEGEQEP FVTGLRDLTS KPVVGVGRFT       300
     SPDTMVRHVT SGILDLIGAA RPSIADPFMP NKIERGDLDD IRECIGCNIC VSGDFTMSPI       360
     RCTQNPTMGE EFRRGWHPES IAPKRSSSSV LVIGAGPAGL EAARALGNRG YPVTVTEASR       420
     ILGGRVVGES KLPGLSAWIR VIDYRLHQIA RLDNVELYRE SAMNADDVLD VGFDHVVVAT       480
     GASWRRDGVG RWHTRPIDIE PGVDVLTPDD IIAGARPQGH RVVLFDDDHY YLGAVIAELL       540
     ASEGFVVTLV TPVPQVSQWT TNTMEAHRIR KRIIEAGVEV RTDTAVSTVM VDGVVTACRF       600
     TGRTGWIDAD SVVLVTARLP HDDLYTALHD RASEWSDAGV QSVRGVGDAW APGTIAAAVW       660
     SGHRFAEELD APLGDAPVPF RREVTQLTIE PVFPRPASSS                             700
//

If you have problems or comments...

PBIL Back to PBIL home page