(data stored in ACNUC1104 zone)

EMBL: CP001966.PE372

CP001966.PE372       Location/Qualifiers
FT   CDS             complement(401742..402035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0385"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mlu:Mlut_10240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77026"
FT                   /db_xref="GOA:D5UMQ2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG77026.1"
FT                   /translation="MPKPYPKEFRDDVVRVARNREPGVRLKQIAADFGISESCLMNWVK
FT                   TADVEAGSKSGSSAAQSATERQMRKRIRLLEQENEVLRRAAAYLSQANLPGK"
     MPKPYPKEFR DDVVRVARNR EPGVRLKQIA ADFGISESCL MNWVKTADVE AGSKSGSSAA        60
     QSATERQMRK RIRLLEQENE VLRRAAAYLS QANLPGK                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page