(data stored in ACNUC1104 zone)

EMBL: CP001966.PE373

CP001966.PE373       Location/Qualifiers
FT   CDS             complement(403499..405001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0386"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rop:ROP_14650
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77027"
FT                   /db_xref="GOA:D5URH4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH4"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADG77027.1"
FT                   /translation="MPEPSDVTSINWHERASTIKLPTTSFIDGRSTPALSRESFDVVNP
FT                   ATDQVLTAVSAGGADDIDAAVKAARRAFDDGRWNGLSPTERGERLIRFADLLLENIEEL
FT                   ALLVTLEMGKVIRDSYTVEVPGAAAVFRYYGEVIDKIPGELPPTADGSVAMVRRIPVGV
FT                   VGAVVPWNFPLDIAAWKVAPALAAGNSVVLKPAEESPLSALRMAEIATEAGIPDGVFNV
FT                   VPGLGTTAGRALGVHPGVQCLAFTGSTEVGKKFLAYSAESNMKQVWLECGGKSPNIVFA
FT                   DYDDLDRAAEMTCFGIFGNQGEVCSANSRLLVQRTIAEEFLTKVVEQAATYRPGDPLDP
FT                   DSITGAMVSEKHLDRVLAACSQAGSDGRTLLGGKRIEGPGYFMEPTVVVDLPLDAAAMT
FT                   DEIFGPVLSVAVFDDEAEAVAIANDTAYGLAGSVWTSSLDRALRVSDALHAGTVSVNTV
FT                   DALSPGTPFGGFGESGFGSDLSVHALDKFTGLKTTWIARHAR"
     MPEPSDVTSI NWHERASTIK LPTTSFIDGR STPALSRESF DVVNPATDQV LTAVSAGGAD        60
     DIDAAVKAAR RAFDDGRWNG LSPTERGERL IRFADLLLEN IEELALLVTL EMGKVIRDSY       120
     TVEVPGAAAV FRYYGEVIDK IPGELPPTAD GSVAMVRRIP VGVVGAVVPW NFPLDIAAWK       180
     VAPALAAGNS VVLKPAEESP LSALRMAEIA TEAGIPDGVF NVVPGLGTTA GRALGVHPGV       240
     QCLAFTGSTE VGKKFLAYSA ESNMKQVWLE CGGKSPNIVF ADYDDLDRAA EMTCFGIFGN       300
     QGEVCSANSR LLVQRTIAEE FLTKVVEQAA TYRPGDPLDP DSITGAMVSE KHLDRVLAAC       360
     SQAGSDGRTL LGGKRIEGPG YFMEPTVVVD LPLDAAAMTD EIFGPVLSVA VFDDEAEAVA       420
     IANDTAYGLA GSVWTSSLDR ALRVSDALHA GTVSVNTVDA LSPGTPFGGF GESGFGSDLS       480
     VHALDKFTGL KTTWIARHAR                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page