(data stored in ACNUC1104 zone)

EMBL: CP001966.PE374

CP001966.PE374       Location/Qualifiers
FT   CDS             405131..405982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0387"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rop:ROP_38490 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77028"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77028.1"
FT                   /translation="MDLRIDGRVFLVSGATRGIGAAVVRTLLAEGACVGGYARRVADEV
FT                   DDSRQLIGAAEAADAGQVRAFVDRCAERFGRVDGVVANAGQGLIAGPDAPLDVWHDQFD
FT                   QRITHAKNLIDAALPHMRRTDAPVIVLLNAVSAHHPDPEMAPVSAARAALASYAATLSH
FT                   HLAPDRIRVVSVDLGMIDTDRQRARHTASQSPIEYDEWLVDEAVRRGIPWGRAGTRRRS
FT                   PTSLAREEGGGRQRGVRCGEQDRFGTAADRMSKAASIRSGIGMLRFARSATPVRDPGCS
FT                   ST"
     MDLRIDGRVF LVSGATRGIG AAVVRTLLAE GACVGGYARR VADEVDDSRQ LIGAAEAADA        60
     GQVRAFVDRC AERFGRVDGV VANAGQGLIA GPDAPLDVWH DQFDQRITHA KNLIDAALPH       120
     MRRTDAPVIV LLNAVSAHHP DPEMAPVSAA RAALASYAAT LSHHLAPDRI RVVSVDLGMI       180
     DTDRQRARHT ASQSPIEYDE WLVDEAVRRG IPWGRAGTRR RSPTSLAREE GGGRQRGVRC       240
     GEQDRFGTAA DRMSKAASIR SGIGMLRFAR SATPVRDPGC SST                         283
//

If you have problems or comments...

PBIL Back to PBIL home page