(data stored in ACNUC1104 zone)

EMBL: CP001966.PE376

CP001966.PE376       Location/Qualifiers
FT   CDS             407180..407938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0389"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rop:ROP_38490 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77030"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77030.1"
FT                   /translation="MDLRIDGRVFLVSGATRGIGAAVVQTLLAEGACVGGYARRVADEV
FT                   DDSRQLIGAAEAADAGQVRAFVDRCAERFGRVDGVVANAGQGLIAGPDAPLDVWHDQFD
FT                   QRITHAKNLIDAALPHMRRTDAPAIVLLNAVSAHHPDPMMAPVSAARAALASYATTLSR
FT                   HLAGDRIRVVSVDIGMIDTPRQRERHAASGSGLDYQDWLAGEAERRGIPWGRAGTTAEV
FT                   ADTVAFLLSPRSSYSTGTSIAIAGGLHPRP"
     MDLRIDGRVF LVSGATRGIG AAVVQTLLAE GACVGGYARR VADEVDDSRQ LIGAAEAADA        60
     GQVRAFVDRC AERFGRVDGV VANAGQGLIA GPDAPLDVWH DQFDQRITHA KNLIDAALPH       120
     MRRTDAPAIV LLNAVSAHHP DPMMAPVSAA RAALASYATT LSRHLAGDRI RVVSVDIGMI       180
     DTPRQRERHA ASGSGLDYQD WLAGEAERRG IPWGRAGTTA EVADTVAFLL SPRSSYSTGT       240
     SIAIAGGLHP RP                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page