(data stored in ACNUC1104 zone)

EMBL: CP001966.PE379

CP001966.PE379       Location/Qualifiers
FT   CDS             complement(409758..410909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0392"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: kra:Krad_0778
FT                   monooxygenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77033"
FT                   /db_xref="GOA:D5URI0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI0"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADG77033.1"
FT                   /translation="MWRTNSLRVAVVGAGIGGLAAAAGLQRAGAEVIVLEQAARFLPRG
FT                   SGLSLFDNGFTALRSLGLEERVRAVTADGPPEIPVGTRTVDGTRVSTFRPETAAGLRVI
FT                   DRTELHQALLGALVPDTVRPGIRVEGVNRDTVDLGPSGLLSYAHVIVGADGIRSRVRGS
FT                   YAGDPGAAYCGYGAWRGITAAPVALEDAGETFGRGERFGYVPLRDGRVYWFAVRPSTAD
FT                   DEPEPGELLERFGQWHDPIPELITATETKRIGYQPIERLARPLRTFSRGQAALVGDAAH
FT                   AMPPTLGQGANLALEDAAVLVSVLRPLATDPDPRAVPAALTSYDKQRRRRTQRIARQAH
FT                   LLGAAGQWPNPLVAFGRDLAFRFAPDGLMDWGMRRVQQWTPPT"
     MWRTNSLRVA VVGAGIGGLA AAAGLQRAGA EVIVLEQAAR FLPRGSGLSL FDNGFTALRS        60
     LGLEERVRAV TADGPPEIPV GTRTVDGTRV STFRPETAAG LRVIDRTELH QALLGALVPD       120
     TVRPGIRVEG VNRDTVDLGP SGLLSYAHVI VGADGIRSRV RGSYAGDPGA AYCGYGAWRG       180
     ITAAPVALED AGETFGRGER FGYVPLRDGR VYWFAVRPST ADDEPEPGEL LERFGQWHDP       240
     IPELITATET KRIGYQPIER LARPLRTFSR GQAALVGDAA HAMPPTLGQG ANLALEDAAV       300
     LVSVLRPLAT DPDPRAVPAA LTSYDKQRRR RTQRIARQAH LLGAAGQWPN PLVAFGRDLA       360
     FRFAPDGLMD WGMRRVQQWT PPT                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page