(data stored in ACNUC1104 zone)

EMBL: CP001966.PE382

CP001966.PE382       Location/Qualifiers
FT   CDS             complement(413334..413816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_50940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77036"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77036.1"
FT                   /translation="MHLEPRVLMQLSGLLDLREGKFFASCFGNRVPDDLLAAVTVHGAA
FT                   TNKATAGFASPSRAQSAMPVEIEHWDDVPPHDGDWDTVLSTTLCVDTSGTVELFSPADG
FT                   AVGEIVEFPMARGYYVVEACARHAGDGADEWRLRLWHSDEVGPDLKEIREIALLAR"
     MHLEPRVLMQ LSGLLDLREG KFFASCFGNR VPDDLLAAVT VHGAATNKAT AGFASPSRAQ        60
     SAMPVEIEHW DDVPPHDGDW DTVLSTTLCV DTSGTVELFS PADGAVGEIV EFPMARGYYV       120
     VEACARHAGD GADEWRLRLW HSDEVGPDLK EIREIALLAR                             160
//

If you have problems or comments...

PBIL Back to PBIL home page