(data stored in ACNUC1104 zone)

EMBL: CP001966.PE385

CP001966.PE385       Location/Qualifiers
FT   CDS             417264..418307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0398"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmi:MMAR_4486 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77039"
FT                   /db_xref="GOA:D5URI6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG77039.1"
FT                   /translation="MKVVVIGAGYAGTIAANRLMKKAGGADVTVVNPRGEFVERVRLHE
FT                   YIAGSGSATTPLADMLNPAIRLVVGSVETIGDGSVTLADGTVLPFDHLVYAAGGAITAP
FT                   AGTVAVGGFESAGRARTALAALPDGALVTVVGGGLTGIETAAEIAESWPALRVRLLSEG
FT                   EIGASLGVGARRRVHRELERLGVQLRRGRYEEPDGAGLVLWAIATQVSDLAARSGLAVD
FT                   DSGRVLVDEFLRSVSDPRIVAVGDGAAVPDARLSCQTALPQGAHGADNLARIIAGAEPK
FT                   RFSMGYTGQNVSIGRRSAVIQTARRDDTPTRIWFGGRPAAFVKEQVCTMARGAARTANY
FT                   AWLPAPK"
     MKVVVIGAGY AGTIAANRLM KKAGGADVTV VNPRGEFVER VRLHEYIAGS GSATTPLADM        60
     LNPAIRLVVG SVETIGDGSV TLADGTVLPF DHLVYAAGGA ITAPAGTVAV GGFESAGRAR       120
     TALAALPDGA LVTVVGGGLT GIETAAEIAE SWPALRVRLL SEGEIGASLG VGARRRVHRE       180
     LERLGVQLRR GRYEEPDGAG LVLWAIATQV SDLAARSGLA VDDSGRVLVD EFLRSVSDPR       240
     IVAVGDGAAV PDARLSCQTA LPQGAHGADN LARIIAGAEP KRFSMGYTGQ NVSIGRRSAV       300
     IQTARRDDTP TRIWFGGRPA AFVKEQVCTM ARGAARTANY AWLPAPK                     347
//

If you have problems or comments...

PBIL Back to PBIL home page