(data stored in ACNUC1104 zone)

EMBL: CP001966.PE388

CP001966.PE388       Location/Qualifiers
FT   CDS             complement(421736..422509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0401"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rha:RHA1_ro05186 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77042"
FT                   /db_xref="GOA:D5URI9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADG77042.1"
FT                   /translation="MSWKDATSKHATSRLRRRATLRRSVRLLSDFRFEQSEPARFYGSL
FT                   ARDTVDLTADLFWEPLDGALVLDVGGGPGYFEDAFAEHGAVYVPIEPDPSEAHAAGITA
FT                   SRGVRGSGLALPIADGAVDVCLSSNVAEHVRDWRAMGAEMLRVTRPGGLVILSYTCWFG
FT                   PFGGHEMGLSHYLGGERAARRYTTKHGHPPKNLYGTSLFKVGANDGLDWAATVDGADLV
FT                   AAFPRYHPSWAWWIVRVPGVREVFTSNLVLAFRKH"
     MSWKDATSKH ATSRLRRRAT LRRSVRLLSD FRFEQSEPAR FYGSLARDTV DLTADLFWEP        60
     LDGALVLDVG GGPGYFEDAF AEHGAVYVPI EPDPSEAHAA GITASRGVRG SGLALPIADG       120
     AVDVCLSSNV AEHVRDWRAM GAEMLRVTRP GGLVILSYTC WFGPFGGHEM GLSHYLGGER       180
     AARRYTTKHG HPPKNLYGTS LFKVGANDGL DWAATVDGAD LVAAFPRYHP SWAWWIVRVP       240
     GVREVFTSNL VLAFRKH                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page