(data stored in ACNUC1104 zone)

EMBL: CP001966.PE395

CP001966.PE395       Location/Qualifiers
FT   CDS             428252..429337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0408"
FT                   /product="mycothiol-dependent formaldehyde dehydrogenase"
FT                   /note="KEGG: rha:RHA1_ro02587 mycothiol-dependent
FT                   formaldehyde dehydrogenase; TIGRFAM: mycothiol-dependent
FT                   formaldehyde dehydrogenase; PFAM: Alcohol dehydrogenase
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77049"
FT                   /db_xref="GOA:D5URJ6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR017816"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ6"
FT                   /inference="protein motif:TFAM:TIGR03451"
FT                   /protein_id="ADG77049.1"
FT                   /translation="MPQVVRGVVARAKGEPTSVVPIVIPDPGPGEVVVSVQACGVCHTD
FT                   LHYREGGINDEFPFLLGHEAAGVVESVGEGVDHVAPGDFVVLNWRAVCGQCRACKRGKP
FT                   QYCFDTFNATQKMTLEDGTELSPALGIGAFAEKTLVHQGQCTRVDATADPAVVGLLGCG
FT                   VMAGLGAAVNTGGVSRGDTVAVIGCGGVGDAAIAGARLVGARTIIAVDRDPKKLDWARD
FT                   LGATHAINAAETDAVEAIQELTGGFGADVVIDAVGRPETWKQAFYARDLAGTVVLVGVP
FT                   TPDMTLDMPLIDFFSHGGSLKSSWYGDCLPERDFPQLVDLYQQGRLPLDKFVTERISLD
FT                   EVEAAFETMHRGEVLRSVVVL"
     MPQVVRGVVA RAKGEPTSVV PIVIPDPGPG EVVVSVQACG VCHTDLHYRE GGINDEFPFL        60
     LGHEAAGVVE SVGEGVDHVA PGDFVVLNWR AVCGQCRACK RGKPQYCFDT FNATQKMTLE       120
     DGTELSPALG IGAFAEKTLV HQGQCTRVDA TADPAVVGLL GCGVMAGLGA AVNTGGVSRG       180
     DTVAVIGCGG VGDAAIAGAR LVGARTIIAV DRDPKKLDWA RDLGATHAIN AAETDAVEAI       240
     QELTGGFGAD VVIDAVGRPE TWKQAFYARD LAGTVVLVGV PTPDMTLDMP LIDFFSHGGS       300
     LKSSWYGDCL PERDFPQLVD LYQQGRLPLD KFVTERISLD EVEAAFETMH RGEVLRSVVV       360
     L                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page