(data stored in ACNUC1104 zone)

EMBL: CP001966.PE396

CP001966.PE396       Location/Qualifiers
FT   CDS             429334..429960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0409"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rer:RER_54690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77050"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ7"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADG77050.1"
FT                   /translation="MSLRTERVITSGQFSLDGGTWDVDNNVWLIGDDAEVVVVDAAHSA
FT                   DPIVAAVGGRTVRAIVCTHGHNDHVTVAPQLSERLDAPILLHPGDDVLWDMTHAGIAHE
FT                   DLADDQRIAVAGTDIQVIHAPGHSPGSVCLYLPEADELFSGDTLFAGGPGATGRSYSDF
FT                   SVIIDSIRDRLFALPPQTRVNTGHGDGTTLGTESPHLEEWIRRGH"
     MSLRTERVIT SGQFSLDGGT WDVDNNVWLI GDDAEVVVVD AAHSADPIVA AVGGRTVRAI        60
     VCTHGHNDHV TVAPQLSERL DAPILLHPGD DVLWDMTHAG IAHEDLADDQ RIAVAGTDIQ       120
     VIHAPGHSPG SVCLYLPEAD ELFSGDTLFA GGPGATGRSY SDFSVIIDSI RDRLFALPPQ       180
     TRVNTGHGDG TTLGTESPHL EEWIRRGH                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page