(data stored in ACNUC1104 zone)

EMBL: CP001966.PE398

CP001966.PE398       Location/Qualifiers
FT   CDS             431633..432331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77052"
FT                   /db_xref="GOA:D5URJ9"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77052.1"
FT                   /translation="MSRPKLGAPFSRWWYAWFAVVAVMMVSSVQDRRWATAVLWLAILA
FT                   AATSEIARSLRQRNLAFGIAGILGVVAALLGYAERDWLAVGLGAMIAVVLVAFLPKIRH
FT                   DVPTCRVRTEELVGRTVADATHLLGFDDRRQPAGLSGPELVPMPPGEQDLGDPELIVTA
FT                   VTVVVDAGTQAQIDAATITFGVADSDDPAIPAAGSATSLALTKSEAQDRLVGIVGGGPA
FT                   DIRPRRFPGS"
     MSRPKLGAPF SRWWYAWFAV VAVMMVSSVQ DRRWATAVLW LAILAAATSE IARSLRQRNL        60
     AFGIAGILGV VAALLGYAER DWLAVGLGAM IAVVLVAFLP KIRHDVPTCR VRTEELVGRT       120
     VADATHLLGF DDRRQPAGLS GPELVPMPPG EQDLGDPELI VTAVTVVVDA GTQAQIDAAT       180
     ITFGVADSDD PAIPAAGSAT SLALTKSEAQ DRLVGIVGGG PADIRPRRFP GS               232
//

If you have problems or comments...

PBIL Back to PBIL home page