(data stored in ACNUC1104 zone)

EMBL: CP001966.PE4

CP001966.PE4         Location/Qualifiers
FT   CDS             4169..5053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0004"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="KEGG: mab:MAB_0003 6-phosphogluconate dehydrogenase-
FT                   like protein; TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76658"
FT                   /db_xref="GOA:D5UPA6"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA6"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ADG76658.1"
FT                   /translation="MQLGLIGLGKMGANMRQRVRAGGHEVVGYDPRPEVTDVPTLEALV
FT                   EALEAPRVVWVMVPAGEPTRETVRKLADLLGEGDLVIDGGNSKYTDDQPNADLLAEKGV
FT                   GYLDCGVSGGVWGLENGYGLMVGGSDADVERAMPIFDALRPEGDRADGFAHSGPVGAGH
FT                   YAKMIHNGIEYGLMQAYGEGYDLLEAEPLIENVAGTLRAWSKGTVVRSWLLDLLVKALE
FT                   EDPGLQEITGYTEDSGEGRWTVEEAIRHSVPAPVIAAALFARFQSRQDDSDTMKAVSAL
FT                   RNQFGGHAVRRAD"
     MQLGLIGLGK MGANMRQRVR AGGHEVVGYD PRPEVTDVPT LEALVEALEA PRVVWVMVPA        60
     GEPTRETVRK LADLLGEGDL VIDGGNSKYT DDQPNADLLA EKGVGYLDCG VSGGVWGLEN       120
     GYGLMVGGSD ADVERAMPIF DALRPEGDRA DGFAHSGPVG AGHYAKMIHN GIEYGLMQAY       180
     GEGYDLLEAE PLIENVAGTL RAWSKGTVVR SWLLDLLVKA LEEDPGLQEI TGYTEDSGEG       240
     RWTVEEAIRH SVPAPVIAAA LFARFQSRQD DSDTMKAVSA LRNQFGGHAV RRAD             294
//

If you have problems or comments...

PBIL Back to PBIL home page