(data stored in ACNUC1104 zone)

EMBL: CP001966.PE40

CP001966.PE40        Location/Qualifiers
FT   CDS             complement(42899..43486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0040"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_5722
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76694"
FT                   /db_xref="GOA:D5UPS6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76694.1"
FT                   /translation="METTTGRPGRPPRLNRDKIVATAIEIVTREGYTKLSMRRLADRLG
FT                   TSPMGIYYYFESKNELLGFIASEHDSVAAYLQGAPSNDPYERTVQTSEAMVRFLCAHAW
FT                   ALSGILDGHIRVEEFMANHLDGLARSIGELGFDEEGTAETVRWIWRIVVGEAMTRSRAA
FT                   PTGGLTDTIESYLAGRLVRVRPRRVGREIGSE"
     METTTGRPGR PPRLNRDKIV ATAIEIVTRE GYTKLSMRRL ADRLGTSPMG IYYYFESKNE        60
     LLGFIASEHD SVAAYLQGAP SNDPYERTVQ TSEAMVRFLC AHAWALSGIL DGHIRVEEFM       120
     ANHLDGLARS IGELGFDEEG TAETVRWIWR IVVGEAMTRS RAAPTGGLTD TIESYLAGRL       180
     VRVRPRRVGR EIGSE                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page