(data stored in ACNUC1104 zone)

EMBL: CP001966.PE400

CP001966.PE400       Location/Qualifiers
FT   CDS             433142..433777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77054"
FT                   /db_xref="GOA:D5URK1"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77054.1"
FT                   /translation="MSLAALMMLPAIALQAAAGNWDLMLLTLGAALALLLADVRSAMRW
FT                   HVLRWTAVVSGIAGAALMMANGSRIFVFGAAVSLLLWGRLALIRQSGANRSAFPSEDLV
FT                   GLTVAEAKGRIGFDDDRAPHGLEEPTLVAVPAADIDLQSPSLIVTGVVVDDREGIMTFG
FT                   VTEPDRLSADLDRDDLQRQLVDQVGGCPADILPLAKPDPLSKYRPRAM"
     MSLAALMMLP AIALQAAAGN WDLMLLTLGA ALALLLADVR SAMRWHVLRW TAVVSGIAGA        60
     ALMMANGSRI FVFGAAVSLL LWGRLALIRQ SGANRSAFPS EDLVGLTVAE AKGRIGFDDD       120
     RAPHGLEEPT LVAVPAADID LQSPSLIVTG VVVDDREGIM TFGVTEPDRL SADLDRDDLQ       180
     RQLVDQVGGC PADILPLAKP DPLSKYRPRA M                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page