(data stored in ACNUC1104 zone)

EMBL: CP001966.PE402

CP001966.PE402       Location/Qualifiers
FT   CDS             435625..436824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0415"
FT                   /product="xylose transporter"
FT                   /note="KEGG: rha:RHA1_ro05189 xylose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77056"
FT                   /db_xref="GOA:D5URK3"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK3"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05189"
FT                   /protein_id="ADG77056.1"
FT                   /translation="MSGLALVTVGSMLANLCSYLVHLPASRWLGPAAYGEFASLLQLSL
FT                   ILAVPALALQTVVARQVVRGAGAEQMRRLGYRVAIGSAVLAALAAPLAAAGLHTRVGTA
FT                   AAALAAAPALVLLAVEQGLLQGERRFRRLALLLGVAGLGKLVFTVPGLLWGVGPALLGT
FT                   TVGALVAAALGRALAGNPAGHDAEADAGVRAVLGASSVQLVLVVFASLDLLLSRPVLGA
FT                   TAAGTYALGAVAAKIAFWLPQAVGVVFFPQLATPERSRSALRIVIALLSGLGVLCVAAA
FT                   AIAAPLATLLAGEEYRAVQGWLWLFAAQGALLALLQGLLLYSIATERTRMSALAWVILA
FT                   VEAAVLLTVPHTVGEMITAAALCAAAAVMVVGLVTGVSAGRDSSDRSPRSATRPASAGR
FT                   "
     MSGLALVTVG SMLANLCSYL VHLPASRWLG PAAYGEFASL LQLSLILAVP ALALQTVVAR        60
     QVVRGAGAEQ MRRLGYRVAI GSAVLAALAA PLAAAGLHTR VGTAAAALAA APALVLLAVE       120
     QGLLQGERRF RRLALLLGVA GLGKLVFTVP GLLWGVGPAL LGTTVGALVA AALGRALAGN       180
     PAGHDAEADA GVRAVLGASS VQLVLVVFAS LDLLLSRPVL GATAAGTYAL GAVAAKIAFW       240
     LPQAVGVVFF PQLATPERSR SALRIVIALL SGLGVLCVAA AAIAAPLATL LAGEEYRAVQ       300
     GWLWLFAAQG ALLALLQGLL LYSIATERTR MSALAWVILA VEAAVLLTVP HTVGEMITAA       360
     ALCAAAAVMV VGLVTGVSAG RDSSDRSPRS ATRPASAGR                              399
//

If you have problems or comments...

PBIL Back to PBIL home page