(data stored in ACNUC1104 zone)

EMBL: CP001966.PE403

CP001966.PE403       Location/Qualifiers
FT   CDS             complement(436754..438085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_11110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77057"
FT                   /db_xref="GOA:D5URK4"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK4"
FT                   /inference="similar to AA sequence:KEGG:RER_11110"
FT                   /protein_id="ADG77057.1"
FT                   /translation="MAEGRSRLARVIGPILIFLGVLLITSAIAGPAYVAGKLKTIPLDL
FT                   DVTTVAQSVKPADSQADAEFPAKSLDLCSIGKQRAVVNEVSVKTQTRTLVQSPSDKSTM
FT                   TVQSGSSMVIPSIKTKGEPRHPELTNANKGERPCDDGLVQAWVDRVSLDRETGAPTGKT
FT                   SETVYSPGESAPAVKVADRKGLQYRFPADTSKENGKYSFYDLITRKNVALDFVEEKEVS
FT                   GTNTLRLRGSQDWVDMSTVRDGNDPTLGTVLTMPAGWWGIGGVDPKDDITLNRWAKTDV
FT                   ELWVDPKTGIIVDQSLHYTQQFRLPAQVVPNTPKPVRDFKMDVFDAQQRWVDDTVRSQA
FT                   EAAKSEQNKLAVAKTVVPIAGGVLGLIALGLGGFALFQGRTAPGGNGGGRRSDDGAAPT
FT                   LPLDDDATAAAPTDDEPVTEAFNAQPKPDESQTEAIDLRNRDQH"
     MAEGRSRLAR VIGPILIFLG VLLITSAIAG PAYVAGKLKT IPLDLDVTTV AQSVKPADSQ        60
     ADAEFPAKSL DLCSIGKQRA VVNEVSVKTQ TRTLVQSPSD KSTMTVQSGS SMVIPSIKTK       120
     GEPRHPELTN ANKGERPCDD GLVQAWVDRV SLDRETGAPT GKTSETVYSP GESAPAVKVA       180
     DRKGLQYRFP ADTSKENGKY SFYDLITRKN VALDFVEEKE VSGTNTLRLR GSQDWVDMST       240
     VRDGNDPTLG TVLTMPAGWW GIGGVDPKDD ITLNRWAKTD VELWVDPKTG IIVDQSLHYT       300
     QQFRLPAQVV PNTPKPVRDF KMDVFDAQQR WVDDTVRSQA EAAKSEQNKL AVAKTVVPIA       360
     GGVLGLIALG LGGFALFQGR TAPGGNGGGR RSDDGAAPTL PLDDDATAAA PTDDEPVTEA       420
     FNAQPKPDES QTEAIDLRNR DQH                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page