(data stored in ACNUC1104 zone)

EMBL: CP001966.PE404

CP001966.PE404       Location/Qualifiers
FT   CDS             438243..439457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0417"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: rop:ROP_52410
FT                   putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77058"
FT                   /db_xref="GOA:D5URK5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK5"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADG77058.1"
FT                   /translation="MTRPDTSDFTIAAPAGAAGFVPALEGMRACAAVTVLLTHTAFQTG
FT                   QVDGSVMGRVWGRFDMAVAVFFALSGFLLWRAHARAAWTHTPRPDTGRYYRSRIVRILP
FT                   AYLVVAVVALALLPRSDPPSGSTWLANLTLTQVFVPFSLTDGLTQMWSLSVEMAFYLLM
FT                   PIAALVLLRMRGARARWRIPTVLAAAAVSLSWAWVGDTLPLPRGVNHHNWLPAYVPWFA
FT                   AGIVLAEVVYAPAHRYRALRRIATRRICWPAAVAVFAVVVTPLGGPVTLDTPAPWQFAT
FT                   RMALGGVLALLLLAPLVLAPSDTPPGRLGSGPMLALGRWSYGIFIWHLVVLSAVFPLFG
FT                   ILAFNGKMMQVTALTVVFSAAVAALSYAWIEEPARRALARYEHRRFAPAPQDAVIEEAE
FT                   EEAAP"
     MTRPDTSDFT IAAPAGAAGF VPALEGMRAC AAVTVLLTHT AFQTGQVDGS VMGRVWGRFD        60
     MAVAVFFALS GFLLWRAHAR AAWTHTPRPD TGRYYRSRIV RILPAYLVVA VVALALLPRS       120
     DPPSGSTWLA NLTLTQVFVP FSLTDGLTQM WSLSVEMAFY LLMPIAALVL LRMRGARARW       180
     RIPTVLAAAA VSLSWAWVGD TLPLPRGVNH HNWLPAYVPW FAAGIVLAEV VYAPAHRYRA       240
     LRRIATRRIC WPAAVAVFAV VVTPLGGPVT LDTPAPWQFA TRMALGGVLA LLLLAPLVLA       300
     PSDTPPGRLG SGPMLALGRW SYGIFIWHLV VLSAVFPLFG ILAFNGKMMQ VTALTVVFSA       360
     AVAALSYAWI EEPARRALAR YEHRRFAPAP QDAVIEEAEE EAAP                        404
//

If you have problems or comments...

PBIL Back to PBIL home page