(data stored in ACNUC1104 zone)

EMBL: CP001966.PE406

CP001966.PE406       Location/Qualifiers
FT   CDS             complement(443678..443878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77060"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77060.1"
FT                   /translation="MDRTTIIASATAALAGIVVAVALALVSGAAAGQSTPSTDINTVSK
FT                   DKGFIEGSSNYGARDDSGANK"
     MDRTTIIASA TAALAGIVVA VALALVSGAA AGQSTPSTDI NTVSKDKGFI EGSSNYGARD        60
     DSGANK                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page