(data stored in ACNUC1104 zone)

EMBL: CP001966.PE41

CP001966.PE41        Location/Qualifiers
FT   CDS             43676..44668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0041"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   cmi:CMM_0578 putative quinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76695"
FT                   /db_xref="GOA:D5UPS7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS7"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADG76695.1"
FT                   /translation="MGDEMRAIVVDEPGPPEVLRLRRRAVPVPAAGEVLIQVEAFGLNR
FT                   SEVHFRSGVATSGSFPRIPGIEAAGIVVLAPGGEFAVGTQVVTMMGGMGREFDGGYAEY
FT                   VCVPAGQVIAFVSDLPWEQIGAVPEMVQTAYGSLHTGVRARPGQSLLVRGGTSSVGMAL
FT                   IVLAKTEGMTVYATTRRAGARELLLDIGADEVFVDDGEVAPAVRHVAVDGVDGAVELVG
FT                   VNVLKDTLRAVKSGGTVCFTGMVSGRWTIPDFYPMDWLPNGVRLTSYSGESSDLPPSIL
FT                   QDFLAAAETGAVRIPVGKVYRLEDIVQAHRDMEAGVIGGKAVVRVDRSD"
     MGDEMRAIVV DEPGPPEVLR LRRRAVPVPA AGEVLIQVEA FGLNRSEVHF RSGVATSGSF        60
     PRIPGIEAAG IVVLAPGGEF AVGTQVVTMM GGMGREFDGG YAEYVCVPAG QVIAFVSDLP       120
     WEQIGAVPEM VQTAYGSLHT GVRARPGQSL LVRGGTSSVG MALIVLAKTE GMTVYATTRR       180
     AGARELLLDI GADEVFVDDG EVAPAVRHVA VDGVDGAVEL VGVNVLKDTL RAVKSGGTVC       240
     FTGMVSGRWT IPDFYPMDWL PNGVRLTSYS GESSDLPPSI LQDFLAAAET GAVRIPVGKV       300
     YRLEDIVQAH RDMEAGVIGG KAVVRVDRSD                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page