(data stored in ACNUC1104 zone)

EMBL: CP001966.PE414

CP001966.PE414       Location/Qualifiers
FT   CDS             complement(449152..450510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0427"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rop:ROP_52490 putative
FT                   3-oxoacyl-[acyl- carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77068"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77068.1"
FT                   /translation="MPDAPSTDFYAAFVKSGPGSFLASRLGLPQPPSLRRYQPGKPALA
FT                   GPVLLGGSGRLVEPVRELLADYDLVVNNGGARGAEKLGGAVFDATGITSIDDLKGLYEF
FT                   FGPQIRSLGNSARIVVLGTTPELIEDIDEHIVQRALEGFTRSVAKELRDGATAQLVYVH
FT                   PKASTGASGLASTLRFLLSGKSAYVDAQVIRITDKDAEAPADWDKPLAGKVALVTGAAR
FT                   GIGATIAEVLSRDGAHVIAADIPAAGEALSEVANKVGGTALPLDVTAPDAGAKIAELVK
FT                   SRHSGLDIVVNNAGITRDKLLANMDEGKWNSVMAVNLKAPKQLVDDLLAAGALNEGGSV
FT                   VDVSSIAGIAGNRGQTNYGATKAGVIGIVDAYTSVLAEKNITINAVAPGFIETAMTAAI
FT                   PLATRQAGRLMNSLQQGGQTVDVAETISYFAAPASAAVTGNVVRVCGQSLLGA"
     MPDAPSTDFY AAFVKSGPGS FLASRLGLPQ PPSLRRYQPG KPALAGPVLL GGSGRLVEPV        60
     RELLADYDLV VNNGGARGAE KLGGAVFDAT GITSIDDLKG LYEFFGPQIR SLGNSARIVV       120
     LGTTPELIED IDEHIVQRAL EGFTRSVAKE LRDGATAQLV YVHPKASTGA SGLASTLRFL       180
     LSGKSAYVDA QVIRITDKDA EAPADWDKPL AGKVALVTGA ARGIGATIAE VLSRDGAHVI       240
     AADIPAAGEA LSEVANKVGG TALPLDVTAP DAGAKIAELV KSRHSGLDIV VNNAGITRDK       300
     LLANMDEGKW NSVMAVNLKA PKQLVDDLLA AGALNEGGSV VDVSSIAGIA GNRGQTNYGA       360
     TKAGVIGIVD AYTSVLAEKN ITINAVAPGF IETAMTAAIP LATRQAGRLM NSLQQGGQTV       420
     DVAETISYFA APASAAVTGN VVRVCGQSLL GA                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page