(data stored in ACNUC1104 zone)

EMBL: CP001966.PE417

CP001966.PE417       Location/Qualifiers
FT   CDS             452409..452912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77071"
FT                   /db_xref="GOA:D5URL8"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77071.1"
FT                   /translation="MGTTGIVIVVVVAIVAISLLISVGWFLRDSNKRIQKFAKSSDLVP
FT                   GRPGRAPAEWSTSSAPEALLHQRVRYAIADVHGNGNPVAVPPPADSAVTGKPGDLDDLD
FT                   DAVFALDDRIIAAAQLPAAERTKALAELEPAVASLEGLTGRLWEAPSHRRHELIDAVIS
FT                   RLRG"
     MGTTGIVIVV VVAIVAISLL ISVGWFLRDS NKRIQKFAKS SDLVPGRPGR APAEWSTSSA        60
     PEALLHQRVR YAIADVHGNG NPVAVPPPAD SAVTGKPGDL DDLDDAVFAL DDRIIAAAQL       120
     PAAERTKALA ELEPAVASLE GLTGRLWEAP SHRRHELIDA VISRLRG                     167
//

If you have problems or comments...

PBIL Back to PBIL home page