(data stored in ACNUC1104 zone)

EMBL: CP001966.PE418

CP001966.PE418       Location/Qualifiers
FT   CDS             complement(452890..453963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0431"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mmi:MMAR_4188
FT                   integral membrane acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77072"
FT                   /db_xref="GOA:D5URL9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL9"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADG77072.1"
FT                   /translation="MVAPTAPAERIPALTGLRASAAFAVCVTHAAFWAGDFTPDAWGAA
FT                   YARLETAVPVFFALSGYLLVRPWLTGTADVRRYFAHRAWRILPAYWAVVTAVYLIYMWR
FT                   SDPSDSGHGWGGYLRNMLFVQVYGVGHVHTGLAQMWSMCVEVAFYLVLPLIGIALVRRA
FT                   PRSWVVPAAMTALTAGWVALVTATELFGKTARTWPPSYAAAFAAGITVALFADRVHWTP
FT                   LRRRALLAAAMLSYAVLLTPLAGPIDLALPNPGQGVLKYLLEALIGGVLVAWAASGPSR
FT                   VLASRPMVWLGGISYEFFLIHVMVMDVVVLDLFGWSLFQGSTGPIAVVTTVLTVPLAWL
FT                   LHTAVERLRRATRATGR"
     MVAPTAPAER IPALTGLRAS AAFAVCVTHA AFWAGDFTPD AWGAAYARLE TAVPVFFALS        60
     GYLLVRPWLT GTADVRRYFA HRAWRILPAY WAVVTAVYLI YMWRSDPSDS GHGWGGYLRN       120
     MLFVQVYGVG HVHTGLAQMW SMCVEVAFYL VLPLIGIALV RRAPRSWVVP AAMTALTAGW       180
     VALVTATELF GKTARTWPPS YAAAFAAGIT VALFADRVHW TPLRRRALLA AAMLSYAVLL       240
     TPLAGPIDLA LPNPGQGVLK YLLEALIGGV LVAWAASGPS RVLASRPMVW LGGISYEFFL       300
     IHVMVMDVVV LDLFGWSLFQ GSTGPIAVVT TVLTVPLAWL LHTAVERLRR ATRATGR          357
//

If you have problems or comments...

PBIL Back to PBIL home page