(data stored in ACNUC1104 zone)

EMBL: CP001966.PE42

CP001966.PE42        Location/Qualifiers
FT   CDS             44811..45920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_A1951 membrane-anchored cell
FT                   surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76696"
FT                   /db_xref="GOA:D5UPS8"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76696.1"
FT                   /translation="MRTAVAATVGAAWAVSGTALIAVLIAIAAGGATYALTAPSPAPAA
FT                   APATTTGTSNDENVRVALKAADDSRTIFGLLSNAVTSSSSGLSAAMSGVPQIFDSVDTA
FT                   RAGAEQVAAGLEETATTQNALNEVSQSAGAWANTLDQVEGISGLSVAVRSSSVQLRKQL
FT                   IDNPTPGSEDTVAQLDQVLAATDGLKTLESVDQLKGSLRSLTSLSDRSATALESARSSA
FT                   RQLRDGLTTISRARPNAESAVGNLSTGMKQLGIALKSIDDQLALIQTRLRDETRDQVEP
FT                   VAAAAPAMDGSARIGWALFAAGIAGVLAYLLALVVHQRVRRVPAAQSPAPLADLARAIS
FT                   EIPTPSHGFPRPDTHNTDPWLPVQFAREK"
     MRTAVAATVG AAWAVSGTAL IAVLIAIAAG GATYALTAPS PAPAAAPATT TGTSNDENVR        60
     VALKAADDSR TIFGLLSNAV TSSSSGLSAA MSGVPQIFDS VDTARAGAEQ VAAGLEETAT       120
     TQNALNEVSQ SAGAWANTLD QVEGISGLSV AVRSSSVQLR KQLIDNPTPG SEDTVAQLDQ       180
     VLAATDGLKT LESVDQLKGS LRSLTSLSDR SATALESARS SARQLRDGLT TISRARPNAE       240
     SAVGNLSTGM KQLGIALKSI DDQLALIQTR LRDETRDQVE PVAAAAPAMD GSARIGWALF       300
     AAGIAGVLAY LLALVVHQRV RRVPAAQSPA PLADLARAIS EIPTPSHGFP RPDTHNTDPW       360
     LPVQFAREK                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page