(data stored in ACNUC1104 zone)

EMBL: CP001966.PE420

CP001966.PE420       Location/Qualifiers
FT   CDS             complement(455973..456641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2368c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77074"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM1"
FT                   /inference="similar to AA sequence:KEGG:MAP2368c"
FT                   /protein_id="ADG77074.1"
FT                   /translation="MDDDQPNDVQLTAVNIGVDGEHGPLFQGIDLEFGPGLHAVQMPAG
FT                   RDQDALLLTLAGRLKPTHGTVDALGATSPGEIRKKCAIAAFADIDELDESVSVETVLSE
FT                   QRRWLAPWYSMVPLSAGRLEMDQVFGELDRPEPKTPIVELTDLQLFLLRITLALLGNRP
FT                   ILIVGDLEQVRDNPGRADAVQRLGAIATRYTVIVGVTNPLGGTAPQHTLHDRRALTRKD
FT                   "
     MDDDQPNDVQ LTAVNIGVDG EHGPLFQGID LEFGPGLHAV QMPAGRDQDA LLLTLAGRLK        60
     PTHGTVDALG ATSPGEIRKK CAIAAFADID ELDESVSVET VLSEQRRWLA PWYSMVPLSA       120
     GRLEMDQVFG ELDRPEPKTP IVELTDLQLF LLRITLALLG NRPILIVGDL EQVRDNPGRA       180
     DAVQRLGAIA TRYTVIVGVT NPLGGTAPQH TLHDRRALTR KD                          222
//

If you have problems or comments...

PBIL Back to PBIL home page